Introduction：Basic information about CAS 11118-25-5|Calcitonin (rat) trifluoroacetate salt, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | Calcitonin (rat) trifluoroacetate salt |
|---|
| CAS Number | 11118-25-5 | Molecular Weight | 3399.83 |
|---|
| Density | / | Boiling Point | / |
|---|
| Molecular Formula | C148H228N40O46S3 | Melting Point | / |
|---|
| MSDS | / | Flash Point | / |
|---|
Names
| Name | Calcitonin rat |
|---|
| Synonym | More Synonyms |
|---|
Calcitonin (rat) trifluoroacetate salt BiologicalActivity
| Description | Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development[1]. |
|---|
| Related Catalog | Research Areas >>OthersSignaling Pathways >>Others >>Others |
|---|
| References | [1]. Birnbaum S, et al. Peptide screening. Current Opinion in Biotechnology, 1992, 3(1): 49-54. |
|---|
Chemical & Physical Properties
| Molecular Formula | C148H228N40O46S3 |
|---|
| Molecular Weight | 3399.83 |
|---|
| Exact Mass | 3397.59000 |
|---|
| PSA | 1455.73000 |
|---|
| Appearance of Characters | powder |
|---|
| Storage condition | −20°C |
|---|
Safety Information
| WGK Germany | 3 |
|---|
| HS Code | 3822009000 |
|---|
Customs
Synonyms
| CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 |
| CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2(DISULFIDE BRIDGE:CYS1-CYS7) |
