Introduction：Basic information about CAS 99658-04-5|GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt |
|---|
| CAS Number | 99658-04-5 | Molecular Weight | 533.688 |
|---|
| Density | 1.3±0.1 g/cm3 | Boiling Point | / |
|---|
| Molecular Formula | C28H35N7O2S | Melting Point | / |
|---|
| MSDS | / | Flash Point | / |
|---|
Names
| Name | Glucagon-like Peptide 1 Amide (Human) |
|---|
| Synonym | More Synonyms |
|---|
BiologicalActivity
| Description | GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells[1]. |
|---|
| Related Catalog | Research Areas >>Metabolic Disease |
|---|
| References | [1]. Schmidtler J, Schepp W, Janczewska I, et al. GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am J Physiol. 1991;260(6 Pt 1):G940-G950. |
|---|
Chemical & Physical Properties
| Density | 1.3±0.1 g/cm3 |
|---|
| Molecular Formula | C28H35N7O2S |
|---|
| Molecular Weight | 533.688 |
|---|
| Exact Mass | 533.257263 |
|---|
| LogP | 3.10 |
|---|
| Index of Refraction | 1.666 |
|---|
| Storage condition | −20°C |
|---|
Safety Information
Synonyms
| Methanesulfonamide, N-methyl-N-[[2-[[[2-[[4-(1-methyl-4-piperidinyl)phenyl]amino][1,2,4]triazolo[1,5-a]pyridin-8-yl]amino]methyl]phenyl]methyl]- |
| N-Methyl-N-(2-{[(2-{[4-(1-methyl-4-piperidinyl)phenyl]amino}[1,2,4]triazolo[1,5-a]pyridin-8-yl)amino]methyl}benzyl)methanesulfonamide |
| HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
