Introduction：Basic information about CAS 11063-17-5|Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt |
|---|
| CAS Number | 11063-17-5 | Molecular Weight | 292.074 |
|---|
| Density | 2.1±0.1 g/cm3 | Boiling Point | 637.8±65.0 °C at 760 mmHg |
|---|
| Molecular Formula | C5H10O10P2 | Melting Point | / |
|---|
| MSDS | / | Flash Point | 339.6±34.3 °C |
|---|
Names
| Name | Gastric Inhibitory Polypeptide (porcine) |
|---|
| Synonym | More Synonyms |
|---|
BiologicalActivity
| Description | Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism[1]. |
|---|
| Related Catalog | Research Areas >>EndocrinologySignaling Pathways >>Protein Tyrosine Kinase/RTK >>Insulin Receptor |
|---|
| References | [1]. G W Morrow, et al. The insulinotropic region of gastric inhibitory polypeptide; fragment analysis suggests the bioactive site lies between residues 19 and 30. Canadian Journal of Physiology and Pharmacology. January 1996. Volume 74. |
|---|
Chemical & Physical Properties
| Density | 2.1±0.1 g/cm3 |
|---|
| Boiling Point | 637.8±65.0 °C at 760 mmHg |
|---|
| Molecular Formula | C5H10O10P2 |
|---|
| Molecular Weight | 292.074 |
|---|
| Flash Point | 339.6±34.3 °C |
|---|
| Exact Mass | 291.974915 |
|---|
| LogP | -1.90 |
|---|
| Vapour Pressure | 0.0±4.1 mmHg at 25°C |
|---|
| Index of Refraction | 1.609 |
|---|
Synonyms
| Butanedioic acid, 3-methyl-2,2-diphosphono- |
| 3-Methyl-2,2-diphosphonosuccinic acid |
| Porcine gastric inhibitory polypeptide |
| Pig gastric inhibitory polypeptide |
| Porcine gastric inhibitory peptide |
| YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
