CAS 99287-08-8|Defensin HNP-1 human
Introduction：Basic information about CAS 99287-08-8|Defensin HNP-1 human, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | Defensin HNP-1 human | ||
|---|---|---|---|
| CAS Number | 99287-08-8 | Molecular Weight | 3442.030 |
| Density | 1.5±0.1 g/cm3 | Boiling Point | / |
| Molecular Formula | C150H228N44O38S6 | Melting Point | / |
| MSDS | USA | Flash Point | / |
Names
| Name | Defensin NP 1 (human reduced) |
|---|---|
| Synonym | More Synonyms |
Defensin HNP-1 human BiologicalActivity
| Description | Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development.Defensin HNP-1 human can regulate the growth of atherosclerosis. |
|---|---|
| Target | Human Endogenous Metabolite |
Chemical & Physical Properties
| Density | 1.5±0.1 g/cm3 |
|---|---|
| Molecular Formula | C150H228N44O38S6 |
| Molecular Weight | 3442.030 |
| Exact Mass | 3439.511475 |
| LogP | -8.95 |
| Index of Refraction | 1.703 |
| InChIKey | KRJOFJHOZZPBKI-UHFFFAOYSA-N |
| SMILES | CCC(C)C1NC(=O)C2CSSCC3NC(=O)C(Cc4ccccc4)NC(=O)C(C)NC(=O)C(Cc4c[nH]c5ccccc45)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)CNC(=O)C(CCC(N)=O)NC(=O)C(Cc4ccc(O)cc4)NC(=O)C(C(C)CC)NC(=O)C(CSSCC(NC(=O)C(Cc4ccc(O)cc4)NC(=O)C(NC(=O)C(C)N)CSSCC(C(=O)O)NC3=O)C(=O)NC(CCCNC(=N)N)C(=O)NC(C(C)CC)C(=O)N3CCCC3C(=O)NC(C)C(=O)N2)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(Cc2ccc(O)cc2)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C(C)NC1=O |
Safety Information
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| RIDADR | NONH for all modes of transport |
Articles6
More Articles| Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37. Infect. Immun. 83 , 4701-9, (2015) Chlamydia trachomatis infection in the lower genital tract can ascend to and cause pathologies in the upper genital tract, potentially leading to severe complications, such as tubal infertility. Howev... | |
| The antimicrobial peptide LL-37 facilitates the formation of neutrophil extracellular traps. Biochem. J. 464(1) , 3-11, (2014) NETs (neutrophil extracellular traps) have been described as a fundamental innate immune defence mechanism. During formation of NETs, the nuclear membrane is disrupted by an as-yet unknown mechanism. ... | |
| Neutrophil serine proteinases and defensins in chronic obstructive pulmonary disease: effects on pulmonary epithelium. Eur. Respir. J. 12 , 1200-1208, (1998) Neutrophils have the capacity to accumulate in high numbers in the lung during infection and inflammation. Because they play an important role in host defence against infection, but may also cause tis... |
Synonyms
| HNP-1, Defensin Human Neutrophil Peptide-1 |
| ACYCRIPACIAGERRYGTCIYQGRLWAFCC(Disulfidebridge:2-30,4-19,9-29) |
