Introduction：Basic information about CAS 106612-94-6|GLP-1 (7-37), including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | GLP-1 (7-37) |
|---|
| CAS Number | 106612-94-6 | Molecular Weight | 3355.666 |
|---|
| Density | 1.5±0.1 g/cm3 | Boiling Point | / |
|---|
| Molecular Formula | C151H228N40O47 | Melting Point | / |
|---|
| MSDS | / | Flash Point | / |
|---|
Names
| Name | h-his-ala-glu-gly-thr-phe-thr-ser-asp-val-ser-ser-tyr-leu-glu-gly-gln-ala-ala-lys-glu-phe-ile-ala-trp-leu-val-lys-gly-arg-gly-oh |
|---|
| Synonym | More Synonyms |
|---|
GLP-1 (7-37) BiologicalActivity
| Description | GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Sequence: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly. |
|---|
| Related Catalog | Signaling Pathways >>GPCR/G Protein >>Glucagon ReceptorResearch Areas >>OthersPeptides |
|---|
| In Vivo | GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion[1]. An intravenous (IV) infusion of GLP-1(7-37) at 0.5, 5, or 50 pmol/min/kg during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp in Sprague-Dawley rats produces a dose-related enhancement of the glucose-induced increase in plasma insulin concentration. Infusion of GLP-1(7-37) (5 pmol/min/kg IV) during a hyperglycemic clamp at two sequentially increasing concentrations of glucose, 11 and 17 mmol/L, produces incremental increases in insulin of 600 and 1,200 pM, respectively. Similarly, infusion of GLP-1(7-37) in hyperinsulinemic, hyperglycemic Zucker diabetic fatty (ZDF) rats produces a transitory increase in plasma insulin concentration and normalizes the plasma glucose concentration. Infusion of GLP-1(7-37) in rats maintains at 11 mM glucose results in a sustained approximately twofold enhancement of the plasma insulin concentration. In rats infused with GLP-1(7-37) for 5 days at 15 pmol/min/kg, there is a small increase in basal plasma insulin concentration and no effect on glucose[2]. |
|---|
| Animal Admin | Rats[2] All experiments are conducted in conscious, catheterized, male Sprague-Dawley rats weighing 300 to 350 g or control rats (body weights, 280 to 320 and 220 to 260 g, respectively). GLP-1(7-37) is infused at 0.5, 5, or 50 pmol/min/kg IV during the second hour of a 2-hour 11-mM hyperglycemic clamp. Glucose (50% solution) is infused at a variable rate to maintain plasma glucose concentration at 11 mM. GLP-1(7-37) (5 pmol/rnin/kg) or vehicle (2% heat-inactivated serum plus 1% sodium acetate in normal saline) is infused via the jugular catheter for 60 minutes[2]. |
|---|
| References | [1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7. |
|---|
Chemical & Physical Properties
| Density | 1.5±0.1 g/cm3 |
|---|
| Molecular Formula | C151H228N40O47 |
|---|
| Molecular Weight | 3355.666 |
|---|
| Exact Mass | 3353.667969 |
|---|
| PSA | 1408.40000 |
|---|
| LogP | -3.86 |
|---|
| Index of Refraction | 1.660 |
|---|
| Storage condition | −20°C |
|---|
| Water Solubility | Soluble in water at 2mg/ml |
|---|
Safety Information
| Safety Phrases | 22-24/25 |
|---|
| WGK Germany | 3 |
|---|
Synonyms
| Preproglucagon 78-108 |
| HuMan GLP-1 |
| Glycine, L-histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alany
 l-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-N-(diaminomethylene)-L-ornithyl- |
| L-Histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alany
 l-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-N-(diaminomethylene)-L-ornithylglycine |
| PREPROGLUCAGON 78-108 HUMAN |
| Tglp-1 |
| GLP-1,7-37 |
| insulinotropin |
| HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY |
| HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| GLP-1 (7-37) Acetate |
| GLP-1(7-37) |
| Human GLP-1 (7-37) |
