CAS 59004-96-5|α-Endorphin
Introduction：Basic information about CAS 59004-96-5|α-Endorphin, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | α-Endorphin | ||
|---|---|---|---|
| CAS Number | 59004-96-5 | Molecular Weight | 1745.95000 |
| Density | / | Boiling Point | / |
| Molecular Formula | C77H120N18O26S | Melting Point | / |
| MSDS | USA | Flash Point | / |
Names
| Name | α-ENDORPHIN |
|---|---|
| Synonym | More Synonyms |
Chemical & Physical Properties
| Molecular Formula | C77H120N18O26S |
|---|---|
| Molecular Weight | 1745.95000 |
| Exact Mass | 1744.83000 |
| PSA | 744.12000 |
Safety Information
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| Safety Phrases | S22-S24/25 |
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3 |
Articles13
More Articles| Live cell monitoring of mu-opioid receptor-mediated G-protein activation reveals strong biological activity of close morphine biosynthetic precursors. J. Biol. Chem. 282 , 27126-32, (2007) G-protein activation by receptors is generally measured using (35)S-GTPgammaS binding assays in cell membranes and cannot be well assessed in intact cells. We have recently developed a fluorescence re... | |
| gamma endorphin, alpha endorphin and Met-enkephalin are formed extracellularly from lipotropin C fragment. Nature 269(5629) , 619-21, (1977) | |
| Selective conversion of beta-endorphin into peptides related to gamma- and alpha-endorphin. Nature 283(5742) , 96-7, (1980) beta-Endorphin (beta-LPH61-91) is a well known endogenous opioid ligand. It and related peptides have recently been implicated in the control of adaptive behaviour. Smaller beta-endorphin fragments ap... |
Synonyms
| YGGFMTSEKSQTPLVT |
| alpha-Endorphin |
| LPH(61-76) |
| a-Endorphin |
| A-ENDORPHIN HUMAN |
| EINECS 262-330-3 |
| MFCD00076381 |
| Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr |
| YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
