CAS 114547-31-8|Galanin (mouse, rat)

Introduction:Basic information about CAS 114547-31-8|Galanin (mouse, rat), including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
Common NameGalanin (mouse, rat)
CAS Number114547-31-8Molecular Weight3164.45000
Density/Boiling Point/
Molecular FormulaC141H211N43O41Melting Point/
MSDSChineseUSAFlash Point/

Names

NameGalanin (1-29) (rat, mouse)
SynonymMore Synonyms

Galanin (mouse, rat) BiologicalActivity

DescriptionGalanin (1-29)(rat, mouse) is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Anticonvulsant effect[1][2].
Related CatalogResearch Areas >>Neurological DiseaseSignaling Pathways >>GPCR/G Protein >>Neuropeptide Y Receptor
References

[1]. Wang S, et al. Cloning and expressional characterization of a novel galanin receptor. Identification of different pharmacophores within galanin for the three galanin receptor subtypes. J Biol Chem. 1997;272(51):31949-31952.

[2]. Mazarati A, et al. Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 2006;318(2):700-708.

Chemical & Physical Properties

Molecular FormulaC141H211N43O41
Molecular Weight3164.45000
Exact Mass3162.57000
PSA1347.03000
InChIKeyJHQDYHHNJBOXKP-UHFFFAOYSA-N
SMILESCCC(C)C(NC(=O)C(C)NC(=O)C(Cc1c[nH]cn1)NC(=O)C1CCCN1C(=O)CNC(=O)C(CC(C)C)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)CNC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(Cc1c[nH]c2ccccc12)NC(=O)CN)C(C)O)C(=O)NC(CC(=O)O)C(=O)NC(CC(N)=O)C(=O)NC(Cc1c[nH]cn1)C(=O)NC(CCCNC(=N)N)C(=O)NC(CO)C(=O)NC(Cc1ccccc1)C(=O)NC(CO)C(=O)NC(CC(=O)O)C(=O)NC(CCCCN)C(=O)NC(Cc1c[nH]cn1)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(C(N)=O)C(C)O

Safety Information

Personal Protective EquipmentEyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
RIDADRNONH for all modes of transport
WGK Germany3

Articles3

More Articles
Galanin is a paracrine inhibitor of gonadotroph function in the female rat.

Endocrinology 39 , 4222-4229, (1998)

Recent evidence suggests that pituitary galanin synthesized in the lactotroph is a paracrine regulator of lactotroph proliferation and PRL secretion and that these effects are mediated via a pituitary...

The GalR2 galanin receptor mediates galanin-induced jejunal contraction, but not feeding behavior, in the rat: differentiation of central and peripheral effects of receptor subtype activation.

FEBS Lett. 434 , 277-82, (1998)

The neuropeptide galanin mediates a diverse array of physiological functions through activation of specific receptors. Roles of the three recently cloned galanin receptors (GalRs) in rat intestinal co...

Pharmacological characterization of the contractile effects of galanin (1-29)-NH2, galantide and galanin (1-14)-(alpha-aminobutyric acid8)scyliorhinin-I in the rat gastric fundus.

Fundam. Clin. Pharmacol. 11 , 576, (1997)

Porcine galanin (1-29)-NH2, galantide (M15) and galanin (1-14)-(alpha-aminobutyric acid8)-scyliorhinin-I used in concentrations of 300, 1,000 and 3,000 nM respectively caused contractions of rat fundu...

Synonyms

GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2
GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2
Rat galanin
H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
GALANIN,RAT
CAS 113731-96-7|RFARKGALRQKNVHEVKN
CAS 115104-28-4|UNII:76LB1G2X6V
Recommended......
TOP