CAS 86784-80-7|Corticotropin-Releasing Factor, human, rat

Introduction:Basic information about CAS 86784-80-7|Corticotropin-Releasing Factor, human, rat, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
Common NameCorticotropin-Releasing Factor, human, rat
CAS Number86784-80-7Molecular Weight4757.45
Density/Boiling Point/
Molecular FormulaC208H344N60O63S2Melting Point/
MSDSUSAFlash Point/

Names

NameCorticotropin-releasing factor (human and rat)
SynonymMore Synonyms

BiologicalActivity

DescriptionCorticotropin-releasing factor (CRF) (human) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary. Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2.
Related CatalogSignaling Pathways >>Others >>OthersResearch Areas >>Neurological DiseasePeptides
In VitroCRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].
In VivoThe findings are consistent with a mechanism whereby the excess CRF that characterizes stress-related diseases initiates distinct cellular processes in male and female brains, as a result of sex-biased CRF1 signaling[2]. CRF injection on food intake (FI), CRF suppresses FI in 3-month male and female animals[3].
References

[1]. Kaneko T et al. Activation of adenylate cyclase-cyclic AMP-protein kinase A signaling by corticotropin-releasing factorwithin the dorsolateral bed nucleus of the stria terminalis is involved in pain-induced aversion. Eur J Neurosci. 2016 Sep 30.

[2]. Bangasser DA et al. Corticotropin-releasing factor overexpression gives rise to sex differences in Alzheimer's disease-related signaling. Mol Psychiatry. 2016 Oct 18.

[3]. Tenk J et al. Acute central effects of corticotropin-releasing factor (CRF) on energy balance: Effects of age and gender. Peptides. 2016 Nov;85:63-72.

Chemical & Physical Properties

Molecular FormulaC208H344N60O63S2
Molecular Weight4757.45
Storage condition−20°C

Safety Information

Personal Protective EquipmentEyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard CodesXi
RIDADRNONH for all modes of transport
WGK Germany3
RTECSGM7925000

Articles6

More Articles
Effects of corticotrophin releasing hormone (CRH) on cell viability and differentiation in the human BeWo choriocarcinoma cell line: a potential syncytialisation inducer distinct from cyclic adenosine monophosphate (cAMP).

Reprod. Biol. Endocrinol. 11 , 30, (2013)

Placental production of corticotrophin releasing hormone (CRH) rises exponentially as pregnancy progresses, and has been linked with the onset of normal and preterm labour. CRH is produced in syncytio...

Modulation of Sleep Homeostasis by Corticotropin Releasing Hormone in REM Sleep-Deprived Rats.

Int. J. Endocrinol. 2010 , 326151, (2010)

Studies have shown that sleep recovery following different protocols of forced waking varies according to the level of stress inherent to each method. Sleep deprivation activates the hypothalamic-pitu...

Identification of a novel interaction between corticotropin releasing hormone (Crh) and macroautophagy.

Sci. Rep. 6 , 23342, (2016)

In inflammatory bowel disease (IBD), compromised restitution of the epithelial barrier contributes to disease severity. Owing to the complexity in the pathogenesis of IBD, a variety of factors have be...

Synonyms

Human corticotropin-releasing hormone-41
Rat/human corticotropin-releasing factor
Corticorelin acetate
Corticorelin
Human CRF(1-41)
MFCD00213806
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Corticorelin (Human)
Corticotropin-releasing factor (human)
CAS 39450-01-6|Protease K
CAS 161982-62-3|Depreotide
Recommended......
TOP