CAS 100040-31-1|Gastric Inhibitory Polypeptide (human)

Introduction:Basic information about CAS 100040-31-1|Gastric Inhibitory Polypeptide (human), including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
Common NameGastric Inhibitory Polypeptide (human)
CAS Number100040-31-1Molecular Weight4983.53
Density/Boiling Point/
Molecular FormulaC226H338N60O66SMelting Point/
MSDSUSAFlash Point/

Names

NameGastric Inhibitory Polypeptide human
SynonymMore Synonyms

Gastric Inhibitory Polypeptide (human) BiologicalActivity

DescriptionGastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
Related CatalogSignaling Pathways >>Others >>OthersResearch Areas >>Metabolic DiseaseNatural Products >>OthersPeptides
In VitroGastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1].
References

[1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13.

Chemical & Physical Properties

Molecular FormulaC226H338N60O66S
Molecular Weight4983.53
Storage condition-20°C

Safety Information

Personal Protective EquipmentEyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter
Hazard CodesXn
RIDADRNONH for all modes of transport
WGK Germany3.0

Articles7

More Articles
Long-term persistence of hormonal adaptations to weight loss.

N. Engl. J. Med. 365 , 1597-1604, (2011)

After weight loss, changes in the circulating levels of several peripheral hormones involved in the homeostatic regulation of body weight occur. Whether these changes are transient or persist over tim...

Pleiotropic effects of GIP on islet function involve osteopontin.

Diabetes 60 , 2424-2433, (2011)

The incretin hormone GIP (glucose-dependent insulinotropic polypeptide) promotes pancreatic β-cell function by potentiating insulin secretion and β-cell proliferation. Recently, a combined analysis of...

Gastric inhibitory polypeptide and its receptor are expressed in the central nervous system and support neuronal survival.

Cent. Nerv. Syst. Agents Med. Chem. 11 , 210-222, (2011)

The development of neuronal apoptosis depends on an intrinsic transcriptional program. By DNA microarray technology, we have previously implicated a number of genes in different paradigms of neuronal ...

Synonyms

MFCD00081634
GIP, human
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Gastric Inhibitory Peptide (GIP), human
CAS 10-27-5|(3R,4R)-3-hydroxy-3,4-bis[(4-hydroxy-3-methoxy-phenyl)methyl]oxolan-2- one
CAS 10022-48-7|Lithium dichromate
Recommended......
TOP