CAS 100040-31-1|Gastric Inhibitory Polypeptide (human)
| Common Name | Gastric Inhibitory Polypeptide (human) | ||
|---|---|---|---|
| CAS Number | 100040-31-1 | Molecular Weight | 4983.53 |
| Density | / | Boiling Point | / |
| Molecular Formula | C226H338N60O66S | Melting Point | / |
| MSDS | USA | Flash Point | / |
Names
| Name | Gastric Inhibitory Polypeptide human |
|---|---|
| Synonym | More Synonyms |
Gastric Inhibitory Polypeptide (human) BiologicalActivity
| Description | Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions. |
|---|---|
| Related Catalog | Signaling Pathways >>Others >>OthersResearch Areas >>Metabolic DiseaseNatural Products >>OthersPeptides |
| In Vitro | Gastric Inhibitory Polypeptide (GIP) exerts various peripheral effects on adipose tissue and lipid metabolism, thereby leading to increased lipid deposition in the postprandial state,sup>[1]. |
| References | [1]. Meier JJ, et al. Gastric inhibitory polypeptide: the neglected incretin revisited. Regul Pept. 2002 Jul 15;107(1-3):1-13. |
Chemical & Physical Properties
| Molecular Formula | C226H338N60O66S |
|---|---|
| Molecular Weight | 4983.53 |
| Storage condition | -20°C |
Safety Information
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|---|
| Hazard Codes | Xn |
| RIDADR | NONH for all modes of transport |
| WGK Germany | 3.0 |
Articles7
More Articles| Long-term persistence of hormonal adaptations to weight loss. N. Engl. J. Med. 365 , 1597-1604, (2011) After weight loss, changes in the circulating levels of several peripheral hormones involved in the homeostatic regulation of body weight occur. Whether these changes are transient or persist over tim... | |
| Pleiotropic effects of GIP on islet function involve osteopontin. Diabetes 60 , 2424-2433, (2011) The incretin hormone GIP (glucose-dependent insulinotropic polypeptide) promotes pancreatic β-cell function by potentiating insulin secretion and β-cell proliferation. Recently, a combined analysis of... | |
| Gastric inhibitory polypeptide and its receptor are expressed in the central nervous system and support neuronal survival. Cent. Nerv. Syst. Agents Med. Chem. 11 , 210-222, (2011) The development of neuronal apoptosis depends on an intrinsic transcriptional program. By DNA microarray technology, we have previously implicated a number of genes in different paradigms of neuronal ... |
Synonyms
| MFCD00081634 |
| GIP, human |
| YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Gastric Inhibitory Peptide (GIP), human |
