PARATHYROID HORMONE (1-34), BOVINE CAS 12583-68-5
Introduction：Basic information about PARATHYROID HORMONE (1-34), BOVINE CAS 12583-68-5, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
PARATHYROID HORMONE (1-34), BOVINE Basic informationDescription
| Product Name: | PARATHYROID HORMONE (1-34), BOVINE |
| Synonyms: | ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE BOVINE;H-ALA-VAL-SER-GLU-ILE-GLN-PHE-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-SER-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-OH;AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF;BPTH 1-34;PTH (1-34) (BOVINE);TERIPARATIDE;PARATHYROID HORMONE (1-34), BOVINE |
| CAS: | 12583-68-5 |
| MF: | C183H288N54O50S2 |
| MW: | 4108.71 |
| EINECS: | 200-001-8 |
| Product Categories: | Neuroscience;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology |
| Mol File: | Mol File |
PARATHYROID HORMONE (1-34), BOVINE Chemical Properties
| storage temp. | −20°C |
| solubility | ≥410.9 mg/mL in DMSO; ≥43.8 mg/mL in H2O; ≥64.6 mg/mL in EtOH |
| form | powder |
| color | White to off-white |
Safety Information
| WGK Germany | 3 |
| Description | Parathyroid hormone (PTH) is an 84 amino acid hormone involved in calcium regulation in counteraction to calcitonin. PTH regulates serum phosphate levels and vitamin D biosynthesis. N-terminal peptides of PTH are used to elicit and study a wide variety of responses in target cells. |
| Uses | Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis[1]. |
| Clinical Use | Active fragment (1-34) of endogenous human parathyroid hormone: Treatment of osteoporosis in postmenopausal women and men at increased risk of fractures Treatment of corticosteroid-induced osteoporosis |
| Side effects | Teriparatide, parathyroid hormone (1–34), is the only anabolic agent available in the United States for the treatment of postmenopausal osteoporosis. Side effects that human should report to doctor or health care professional as soon as possible: allergic reactions like skin rash, itching or hives, swelling of the face, lips, or tongue blood in the urine; pain in the lower back or side; pain when urinating signs and symptoms of low blood pressure like dizziness; feeling faint or lightheaded, falls; unusually weak or tired signs and symptoms of increased calcium like nausea; vomiting; constipation; low energy; or muscle weakness |
| in vivo | Parathyroid Hormone (1-34)(subcutaneous?injection; 80 μg/kg; 5 days) increases serum osteocalcin concentrations without changing serum inorganic phosphate or calcium concentrations in either group of old animals.?Serum 1,25-dihydroxyvitamin D concentrations are significantly higher in the PTH-treated senile female rats than the sex-matchedvehicle-treated controls[1]. |
| Metabolism | No metabolism or excretion studies have been performed. Peripheral metabolism of PTH is believed to occur by non-specific enzymatic mechanisms in the liver followed by excretion via the kidneys. The 24-hour urine excretion of calcium was reduced by a clinically unimportant amount (15%). |
| References | [1] B H Mitlak, et al. Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. J Bone Miner Res. 1992 May;7(5):479-84. DOI:10.1002/jbmr.5650070503 [2] M Takigawa, et al. Studies on chondrocytes from mandibular condylar cartilage, nasal septal cartilage, and spheno-occipital synchondrosis in culture. I. Morphology, growth, glycosaminoglycan synthesis, and responsiveness to bovine parathyroid hormone (1-34). J Dent Res. 1984 Jan;63(1):19-22. DOI:10.1177/00220345840630010201 |
PARATHYROID HORMONE (1-34), BOVINE Preparation Products And Raw materials
