Introduction:Basic information about CAS 134500-80-4|Amyloid β-Protein (1-43), including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
| Common Name | Amyloid β-Protein (1-43) |
|---|
| CAS Number | 134500-80-4 | Molecular Weight | 4615.211 |
|---|
| Density | / | Boiling Point | / |
|---|
| Molecular Formula | C207H318N56O62S | Melting Point | / |
|---|
| MSDS | USA | Flash Point | / |
|---|
Names
| Name | beta-amyloid (1-43) |
|---|
| Synonym | More Synonyms |
|---|
Amyloid β-Protein (1-43) BiologicalActivity
| Description | Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease. |
|---|
Chemical & Physical Properties
| Molecular Formula | C207H318N56O62S |
|---|
| Molecular Weight | 4615.211 |
|---|
| Exact Mass | 4614.324 |
|---|
| InChIKey | YQWMUHTZOOEROI-UIBFZGNWSA-N |
|---|
| SMILES | CCC(C)C(NC(=O)C(C)NC(=O)CNC(=O)C(CCCCN)NC(=O)C(CC(N)=O)NC(=O)C(CO)NC(=O)CNC(=O)C(NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(Cc1ccccc1)NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CCCCN)NC(=O)C(CCC(N)=O)NC(=O)C(Cc1c[nH]cn1)NC(=O)C(Cc1c[nH]cn1)NC(=O)C(NC(=O)C(CCC(=O)O)NC(=O)C(Cc1ccc(O)cc1)NC(=O)CNC(=O)C(CO)NC(=O)C(CC(=O)O)NC(=O)C(Cc1c[nH]cn1)NC(=O)C(CCCNC(=N)N)NC(=O)C(Cc1ccccc1)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C(N)CC(=O)O)C(C)C)C(C)C)C(C)C)C(=O)NC(C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(CCSC)C(=O)NC(C(=O)NCC(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C)C(=O)NC(C(=O)O)C(C)O)C(C)CC)C(C)C)C(C)C)C(C)C)C(C)CC |
|---|
| Storage condition | −20°C |
|---|
Safety Information
| Personal Protective Equipment | Eyeshields;Gloves;type N95 (US);type P1 (EN143) respirator filter |
|---|
| RIDADR | NONH for all modes of transport |
|---|
| WGK Germany | 3 |
|---|
Articles1
More Articles
| Neurodegeneration induced by beta-amyloid peptides in vitro: the role of peptide assembly state. J. Neurosci. 13 , 1676, (1993) The progressive neurodegeneration of Alzheimer's disease has been hypothesized to be mediated, at least in part, by beta-amyloid protein. A relationship between the aggregation state of beta-amyloid p... | |
Synonyms
| a-beta (1-43) |
| daefrhdsgyevhhqklvffaedvgsnkgaiiglmvggvviat |
| beta-amyloid (1-43) |
| amyloid beta-protein (1-43) |
| MFCD00240623 |
| beta-amyloid peptide [1-43], human |
| beta-amyloid (1-43) peptide |
| h-asp-ala-glu-phe-arg-his-asp-ser-gly-tyr-glu-val-his-his-gln-lys-leu-val-phe-phe-ala-glu-asp-val-gly-ser-asn-lys-gly-ala-ile-ile-gly-leu-met-val-gly-gly-val-val-ile-ala-thr-oh |
| h2n-d-a-e-f-r-h-d-s-g-y-e-v-h-h-q-k-l-v-f-f-a-e-d-v-g-s-n-k-g-a-i-i-g-l-m-v-g-g-v-v-i-a-t-oh |