CAS 138398-61-5|Amylin (8-37) (mouse, rat)

Introduction：Basic information about CAS 138398-61-5|Amylin (8-37) (mouse, rat), including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.

Table of Contents

1. Names
2. Amylin (8-37) (mouse, rat) BiologicalActivity
3. Chemical & Physical Properties
4. Synonyms

Common Name	Amylin (8-37) (mouse, rat)
CAS Number	138398-61-5	Molecular Weight	3200.56000
Density	/	Boiling Point	/
Molecular Formula	C₁₄₀H₂₂₇N₄₃O₄₃	Melting Point	/
MSDS	/	Flash Point	/

Names

Name	amylin (8-37) (rat)
Synonym	More Synonyms

Amylin (8-37) (mouse, rat) BiologicalActivity

Description	Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
Related Catalog	Signaling Pathways >>Others >>OthersResearch Areas >>Metabolic DiseasePeptides
Target	Amylin receptor (AMY)[1]
In Vitro	Amylin (8-37), rat (Rat amylin-(8-37)) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Amylin (8-37) reduces plasma insulin (P<0.001) and enhances several measures of whole body and muscle insulin sensitivity (P<0.05) in both saline- and hGH-infused rats. Amylin-(8-37) corrects hGH-induced liver insulin resistance, increases basal plasma triglycerides and lowers plasma nonesterified fatty acids in both groups, and reduces muscle triglyceride and total long-chain acyl-CoA content in saline-treated rats (P<0.05). In isolated soleus muscle, Amylin (8-37) blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Thus 1) hyperamylinemia accompanies insulin resistance induced by hGH infusion; 2) Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin resistant rats; and 3) Amylin (8-37) elicits a significant alteration of in vivo lipid metabolism[2].
References	[1]. Bower RL, et al. Amylin structure-function relationships and receptor pharmacology: implications for amylin mimetic drug development. Br J Pharmacol. 2016 Jun;173(12):1883-98. [2]. Hettiarachchi M, et al. Rat amylin-(8-37) enhances insulin action and alters lipid metabolism in normal and insulin-resistant rats. Am J Physiol. 1997 Nov;273(5 Pt 1):E859-67.

Chemical & Physical Properties

Molecular Formula	C₁₄₀H₂₂₇N₄₃O₄₃
Molecular Weight	3200.56000
Exact Mass	3198.69000
PSA	1410.59000
InChIKey	KXIRMGRGEHRNNC-ANJGTFPLSA-N
SMILES	CC(C)CC(NC(=O)C(CC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(CCCNC(=N)N)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(Cc1ccccc1)NC(=O)C(CC(N)=O)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCC(N)=O)NC(=O)C(NC(=O)C(C)N)C(C)O)C(C)C)C(=O)NCC(=O)N1CCCC1C(=O)NC(C(=O)NC(CC(C)C)C(=O)N1CCCC1C(=O)N1CCCC1C(=O)NC(C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NCC(=O)NC(CO)C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(Cc1ccc(O)cc1)C(N)=O)C(C)O)C(C)C)C(C)O)C(C)C

Synonyms

Amylin (8-37) (mouse,rat)

ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2

H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

diabetes associated peptide amide*fragment 8-37 R

Amylin (8-37), rat

Recommended......