Introduction：Basic information about CALCITONIN, HUMAN CAS 21215-62-3, including its chemical name, molecular formula, synonyms, physicochemical properties, and safety information, etc.
CALCITONIN, HUMAN Basic information
| Product Name: | CALCITONIN, HUMAN |
| Synonyms: | calcitonin M;THYROCALCITONIN HUMAN;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 (DISULFIDE BRIDGE: 1-7);CYST-GLY-ASN-LEU-SER-THR-CYST-MET-LEU-GLY-THR-TYR-THR-GLN-AS-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO NH2;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 HUMAN;CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (DISULFIDE BRIDGE: 1-7) |
| CAS: | 21215-62-3 |
| MF: | C151H226N40O45S3 |
| MW: | 3417.85 |
| EINECS: | 244-276-2 |
| Product Categories: | Peptide;Calcitonin and CGRP receptor |
| Mol File: | 21215-62-3.mol |
|
CALCITONIN, HUMAN Chemical Properties
| Boiling point | 3061.8±65.0 °C(Predicted) |
| density | 1.326±0.06 g/cm3(Predicted) |
| RTECS | XP3560000 |
| storage temp. | −20°C |
| solubility | Soluble in DMSO |
| form | powder |
| color | White to off-white |
| biological source | synthetic (organic) |
| Water Solubility | Soluble to 2 mg/ml in water |
| Merck | 13,1642 |
| Sequence | Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge:Cys1-Cys7) |
| InChIKey | LDVRMNJZLWXJPL-JKQNMTHDSA-N |
Safety Information
| Safety Statements | 22-24/25 |
| WGK Germany | 3 |
| Storage Class | 11 - Combustible Solids |
CALCITONIN, HUMAN Usage And Synthesis
| Uses | Regulator (calcium). |
| Uses | Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. A carrier peptide that can be used to internalize fusion proteins |
| Uses | Calcitonin human has been used to study its ability to stimulate cAMP production post transfection in mammalian cell by activating human CALCRL (calcitonin receptor like receptor gene)- receptor activity-modifying protein 1 (RAMP1) and CTR (calcitonin receptor). |
| Brand name | Calcimar (Rhone-Poulenc Rorer);. |
| Biochem/physiol Actions | Calcitonin, also referred to as thyrocalcitonin, is a 32 amino acid peptide hormone, which is present abundantly in seminal plasma compared to serum. It acts as a first messenger and hence regulates the the production of cAMP as well as mammalian sperm function. It also facilitates the regulation of different isoforms of adenylyl cyclase. |
| in vivo | Calcitonin (oral gavage; 2 mg/kg; once daily; 9 w) can inhibit cartilage degradation and prevent cartilage erosion[3]. | Animal Model: | Female Sprague-Dawley rats[3] | | Dosage: | 2 mg/kg | | Administration: | Oral gavage; 2 mg/kg; once daily; 9 weeks | | Result: | Suppressed ovariectomy-induced cartilage degradation (P<0.001) compared with the carrier control.
Prevented cartilage erosion compared with treatment with the carrier alone (P<0.01), and the extent of erosions was comparable with that in sham-operated animals. |
|
| storage | Store at -20°C |
CALCITONIN, HUMAN Preparation Products And Raw materials
